PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_017498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BBR-BPC
Protein Properties Length: 325aa    MW: 36200.2 Da    PI: 9.9895
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_017498genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind383.63.1e-11713241301
    GAGA_bind   1 mdddgsre..rnkgyyepa.aslkenl..glqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla. 92 
                  md++g+re  r+k+    + + l +n+   +q+m+++aerda+i+ern+alsekk+a+aerdma lqrd+a+aern a+verdn++++l+++ens++ 
  DCAR_017498   1 MDNSGHREngRHKPP---QgQWLMQNQpsMKQIMAIMAERDAAIQERNMALSEKKSAMAERDMAILQRDSAIAERNSAIVERDNAIATLQYRENSMSn 95 
                  999999877777772...2222333321135****************************************************************999 PP

    GAGA_bind  93 ...salpvgvqvlsgtksidslqqlse..pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekk.ak.kkkkksekskkkvkkes 182
                     s++p+g+++++g+k++++ qq+ +  ++l++ a   +r+++++ea p++  ++e  ++k++k++++a+ +k++   + k+kk+se+ + ++ k +
  DCAR_017498  96 gnmSTCPPGCHISRGVKHMHHPQQHVHdqSHLSEAASFgTRDMHTTEAIPTSPLVPEPAKSKQTKRTKKATPNKKTPrPSkKVKKESEDVNITKWKGG 193
                  99999*******************666566777765444*************9999999999988766665544433022144443333333333333 PP

    GAGA_bind 183 ader..............skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafk 266
                  +  +              sk ++k++dl+ln+v +De+t+PvP+CsCtG+lr CYkWGnGGWqS+CCttt+S+yPLP ++++r+aRi+grKmS+gaf+
  DCAR_017498 194 H--EmsggvndlnrelvvSKLDWKDQDLGLNQVPFDETTMPVPICSCTGVLRPCYKWGNGGWQSSCCTTTLSMYPLPCVPNKRHARIGGRKMSGGAFN 289
                  2..256999***************************************************************************************** PP

    GAGA_bind 267 klLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                  klL +LaaeG+dlsnpvDL+dhWAkHGtn+++ti+
  DCAR_017498 290 KLLTRLAAEGHDLSNPVDLRDHWAKHGTNRYITIK 324
                  **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062173.9E-1031324IPR010409GAGA-binding transcriptional activator
SMARTSM012263.3E-1631324IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDNSGHRENG RHKPPQGQWL MQNQPSMKQI MAIMAERDAA IQERNMALSE KKSAMAERDM  60
AILQRDSAIA ERNSAIVERD NAIATLQYRE NSMSNGNMST CPPGCHISRG VKHMHHPQQH  120
VHDQSHLSEA ASFGTRDMHT TEAIPTSPLV PEPAKSKQTK RTKKATPNKK TPRPSKKVKK  180
ESEDVNITKW KGGHEMSGGV NDLNRELVVS KLDWKDQDLG LNQVPFDETT MPVPICSCTG  240
VLRPCYKWGN GGWQSSCCTT TLSMYPLPCV PNKRHARIGG RKMSGGAFNK LLTRLAAEGH  300
DLSNPVDLRD HWAKHGTNRY ITIK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884822.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884823.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884824.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884825.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_015884826.10.0PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-146BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A0L9V9700.0A0A0L9V970_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RAS60.0A0A0S3RAS6_PHAAN; Uncharacterized protein
STRINGGLYMA04G02860.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53532338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-141basic pentacysteine 6